McDonnell Genome Institute

Washington University

Transcript

PTOV1-AS2:1

Chromosome

chr19

Gene Name

PTOV1-AS2

Start

49854966

CPC Label

noncoding

End

49859553

Cancer

OV

Strand

-

Peptide

EKGGPSGTQGAQRQLGR

Modified Peptide

n[145]EKGGPSGTQGAQRQLGR

Peptide Length

17

ORF Length

65

Open Reading Frame (ORF)

LREKGGPSGTQGAQRQLGRVEADCPNREQGLGMSQSQVLWADNSLPPHPCLLSSTCHLSQPKPPF

Conservation Score

0.06

PhyloCSF Frame 1

-4.853

No. of Spectra

1

CPC Coding Probability

0.124701

PhyloCSF Frame 2 

-4.317

CNTI Index

noncoding

Max Probability

0.1912

PhyloCSF Frame 3

-4.168

CNTI Score

-0.288094232