McDonnell Genome Institute

Washington University

Transcript

PTOV1-AS1:4

Chromosome

chr19

Gene Name

PTOV1-AS1

Start

49839226

CPC Label

noncoding

End

49851057

Cancer

OSCC

Strand

-

Peptide

GGNGSPYRMGWQK

Modified Peptide

n[145]GGNGSPYRM[147]GWQK

Peptide Length

13

ORF Length

76

Open Reading Frame (ORF)

LGRRASHNFRGRGGNGSPYRMGWQKNEGDTKLAPCGGRDGGRPHPEPWARRARRPRQNTSGKRGGRNNGPGDKGTH

Conservation Score

0.27

PhyloCSF Frame 1

-2.926

No. of Spectra

1

CPC Coding Probability

0.0250062

PhyloCSF Frame 2 

-3.788

CNTI Index

noncoding

Max Probability

0.1673

PhyloCSF Frame 3

-4.062

CNTI Score

-0.320059321