McDonnell Genome Institute

Washington University

Transcript

PTCHD1-AS:7

Chromosome

chrX

Gene Name

PTCHD1-AS

Start

23290147

CPC Label

noncoding

End

23293144

Cancer

LUAD

Strand

-

Peptide

MEHGEHEGLK

Modified Peptide

n[230]MEHGEHEGLK

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

MEHGEHEGLKECCFCLFVCLFLRRSLALSPMLECSGAISAHCNLRLVGSSDSHASAS

Conservation Score

0.054

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0785787

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.376845508