McDonnell Genome Institute

Washington University

Transcript

PSORS1C3:4

Chromosome

chr6

Gene Name

PSORS1C3

Start

31171608

CPC Label

noncoding

End

31176821

Cancer

OV

Strand

-

Peptide

GAVMVLSWGLR

Modified Peptide

n[145]GAVMVLSWGLR

Peptide Length

11

ORF Length

54

Open Reading Frame (ORF)

LADSREMHDKGAVMVLSWGLRWLGRGLLLFRSMFLPPPPGPIIYLPFGQLKAEK

Conservation Score

1

PhyloCSF Frame 1

-3.061

No. of Spectra

2

CPC Coding Probability

0.228702

PhyloCSF Frame 2 

-2.103

CNTI Index

noncoding

Max Probability

0.8696

PhyloCSF Frame 3

-1.085

CNTI Score

-0.323571045