McDonnell Genome Institute

Washington University

Transcript

PSMG3-AS1:21

Chromosome

chr7

Gene Name

PSMG3-AS1

Start

1570081

CPC Label

noncoding

End

1578162

Cancer

OV

Strand

+

Peptide

LSNWGGECGIK

Modified Peptide

n[145]LSNWGGECGIK

Peptide Length

11

ORF Length

64

Open Reading Frame (ORF)

LLCFLGGSYLLSRLSNWGGECGIKEEGVARWSCLWKVGSVVGWEGGKGLTARRSCLCLWVSLEA

Conservation Score

0.029

PhyloCSF Frame 1

-4.348

No. of Spectra

1

CPC Coding Probability

0.148005

PhyloCSF Frame 2 

-5.626

CNTI Index

noncoding

Max Probability

0.8297

PhyloCSF Frame 3

-4.368

CNTI Score

-0.293081336