McDonnell Genome Institute

Washington University

Transcript

PSMG3-AS1:19

Chromosome

chr7

Gene Name

PSMG3-AS1

Start

1586009

CPC Label

coding

End

1622683

Cancer

OSCC

Strand

+

Peptide

NAGLQVWLVK

Modified Peptide

n[145]NAGLQVWLVK

Peptide Length

10

ORF Length

120

Open Reading Frame (ORF)

LKPREGKQCLLGHTAHQGQGRDERREKDQRNAGLQVWLVKGTTEISSLGPSLSGDGFPPCCWGQWPPDVLNAHPPSIVTQRVTAIILSGREFPGKTESCARAARHGPGVSWSRAGEGSAP

Conservation Score

0.152

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.969807

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.696

PhyloCSF Frame 3

0

CNTI Score

-0.326159706