McDonnell Genome Institute

Washington University

Transcript

PSMG3-AS1:1

Chromosome

chr7

Gene Name

PSMG3-AS1

Start

1570072

CPC Label

coding

End

1589626

Cancer

EOGC

Strand

+

Peptide

RAVCSGQWFLGHCMVLASLQGPPSLAAASQPR

Modified Peptide

n[145]RAVCSGQWFLGHCM[147]VLASLQGPPSLAAASQPR

Peptide Length

32

ORF Length

149

Open Reading Frame (ORF)

LGPSLGSCLRVGGLSSLFECSTRSRKRAVCSGQWFLGHCMVLASLQGPPSLAAASQPRAGPFCQLKAERPAALGWRRAEKPPGVVSVLLKVMLTPVSQAAGRVAVRSVVTGLHHCGLPPREQLCPTTASLQLLPSAWAGAEPGVWVGEA

Conservation Score

0.109

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.71034

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7183

PhyloCSF Frame 3

-2.673

CNTI Score

-0.294390434