McDonnell Genome Institute

Washington University

Transcript

PRR7-AS1:8

Chromosome

chr5

Gene Name

PRR7-AS1

Start

177442812

CPC Label

coding

End

177455797

Cancer

CCRC

Strand

-

Peptide

RVTSRLEVSPVGFPR

Modified Peptide

Peptide Length

15

ORF Length

152

Open Reading Frame (ORF)

MAPAGARACLTRGRAGPVGQTRGAVKARRGPQRLPGPRPRPAQSGESLLRGNLALPGGPVTSPRRVTSRLEVSPVGFPRSEPRPPPRSPGAEGSRGGPAGGARRTDSSSESEREIRHPQSRGQRVSGACAHQVPEEASRRRCCAAGKGWYIS

Conservation Score

1

PhyloCSF Frame 1

0.226

No. of Spectra

1

CPC Coding Probability

0.90686

PhyloCSF Frame 2 

3.202

CNTI Index

coding

Max Probability

0.0735

PhyloCSF Frame 3

-0.176

CNTI Score

0.766473814