McDonnell Genome Institute

Washington University

Transcript

PRR7-AS1:10

Chromosome

chr5

Gene Name

PRR7-AS1

Start

177448051

CPC Label

coding

End

177452141

Cancer

OV

Strand

-

Peptide

GWLCVQFIPGK

Modified Peptide

n[145]GWLCVQFIPGK

Peptide Length

11

ORF Length

58

Open Reading Frame (ORF)

LVGLLAVGPGEYLKGWLCVQFIPGKCQPFTKTSLREEPSPSPRLAGQFISKWRPHVST

Conservation Score

0.53

PhyloCSF Frame 1

-3.461

No. of Spectra

5

CPC Coding Probability

0.970999

PhyloCSF Frame 2 

-3.923

CNTI Index

noncoding

Max Probability

0.8679

PhyloCSF Frame 3

-4.524

CNTI Score

-0.31017