McDonnell Genome Institute

Washington University

Transcript

PROX1-AS1:54

Chromosome

chr1

Gene Name

PROX1-AS1

Start

213832590

CPC Label

noncoding

End

213841362

Cancer

HCC

Strand

-

Peptide

KEVAIGK

Modified Peptide

n[230]KEVAIGK

Peptide Length

7

ORF Length

85

Open Reading Frame (ORF)

LLGACWRKEVAIGKLNRFTDHQGRTILLLMQSSVVHVTITVDQFNRGVKKRKMYILRSLIWNGSVEQSGSKKFKHLFYFWETIEK

Conservation Score

0.996

PhyloCSF Frame 1

-5.212

No. of Spectra

6

CPC Coding Probability

0.0305668

PhyloCSF Frame 2 

-3.27

CNTI Index

noncoding

Max Probability

0.8667

PhyloCSF Frame 3

-4.077

CNTI Score

-0.470069935