McDonnell Genome Institute

Washington University

Transcript

PROX1-AS1:10

Chromosome

chr1

Gene Name

PROX1-AS1

Start

213983798

CPC Label

noncoding

End

213987670

Cancer

OV

Strand

-

Peptide

AAAFSWVSGCPGQDLRPEPPISGDSR

Modified Peptide

n[145]AAAFSWVSGCPGQDLRPEPPISGDSR

Peptide Length

26

ORF Length

94

Open Reading Frame (ORF)

LPRRFAARIRAQERRLEIGARATLGERDRFAAQLRELPRRSPVPCPVLYCRGGVQARLLATSLARAAAFSWVSGCPGQDLRPEPPISGDSRFVF

Conservation Score

1

PhyloCSF Frame 1

7.014

No. of Spectra

3

CPC Coding Probability

0.104632

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9002

PhyloCSF Frame 3

0

CNTI Score

-0.291985796