McDonnell Genome Institute

Washington University

Transcript

PRNCR1:1

Chromosome

chr8

Gene Name

PRNCR1

Start

127079873

CPC Label

noncoding

End

127092595

Cancer

OSCC

Strand

+

Peptide

YTDVNLHIIK

Modified Peptide

n[145]YTDVNLHIIK

Peptide Length

10

ORF Length

76

Open Reading Frame (ORF)

MVASKYTDVNLHIIKFCIRETLIWGDMQCPINGSFLQCPQASLPVCVFPPGCSYQDSALGIYGQGYQVLIKLTLSN

Conservation Score

0.936

PhyloCSF Frame 1

-4.287

No. of Spectra

5

CPC Coding Probability

0.158414

PhyloCSF Frame 2 

-4.665

CNTI Index

coding

Max Probability

0.9938

PhyloCSF Frame 3

-4.642

CNTI Score

0.663893152