McDonnell Genome Institute

Washington University

Transcript

PRKG1-AS1:8

Chromosome

chr10

Gene Name

PRKG1-AS1

Start

52251964

CPC Label

noncoding

End

52297915

Cancer

LUAD

Strand

-

Peptide

NSSMFSR

Modified Peptide

n[230]NSSMFSR

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LFTALYTVSGSSSHTVLVSDIRNSSMFSREVEINLHSQLGFIATPS

Conservation Score

1

PhyloCSF Frame 1

-2.044

No. of Spectra

1

CPC Coding Probability

0.0116515

PhyloCSF Frame 2 

0.279

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

-5.349

CNTI Score

-0.397103062