McDonnell Genome Institute

Washington University

Transcript

PRKCQ-AS1:45

Chromosome

chr10

Gene Name

PRKCQ-AS1

Start

6580505

CPC Label

noncoding

End

6626686

Cancer

BRCA-Luminal B

Strand

+

Peptide

MNQVPHGAGSVVDTGNMK

Modified Peptide

n[145]M[147]NQVPHGAGSVVDTGNMK

Peptide Length

18

ORF Length

51

Open Reading Frame (ORF)

MNQVPHGAGSVVDTGNMKESTDRDPLPSRSPHSSRKRQAINKAKKYVIHCV

Conservation Score

0.046

PhyloCSF Frame 1

-5.236

No. of Spectra

23

CPC Coding Probability

0.0315202

PhyloCSF Frame 2 

-4.646

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

-5.41

CNTI Score

-0.333259629