McDonnell Genome Institute

Washington University

Transcript

PRKCQ-AS1:22

Chromosome

chr10

Gene Name

PRKCQ-AS1

Start

6583830

CPC Label

noncoding

End

6615893

Cancer

OSCC

Strand

+

Peptide

MCLLPSTMIVRPPQPHR

Modified Peptide

n[145]MCLLPSTMIVRPPQPHR

Peptide Length

17

ORF Length

38

Open Reading Frame (ORF)

MCLLPSTMIVRPPQPHRTESILNFLCKLGKAVDNRWML

Conservation Score

0.207

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.013895

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.400798461