McDonnell Genome Institute

Washington University

Transcript

PRKCA-AS1:1

Chromosome

chr17

Gene Name

PRKCA-AS1

Start

66398068

CPC Label

noncoding

End

66416854

Cancer

OV

Strand

-

Peptide

EINVIMLAHFLLAFFSR

Modified Peptide

n[145]EINVIM[147]LAHFLLAFFSR

Peptide Length

17

ORF Length

66

Open Reading Frame (ORF)

LENVEEYKEKKNYSFYEHREINVIMLAHFLLAFFSRSEEEEGWCIFMKLLTQTQNTAISLLKSQRY

Conservation Score

0.085

PhyloCSF Frame 1

-4.492

No. of Spectra

1

CPC Coding Probability

0.116988

PhyloCSF Frame 2 

-4.749

CNTI Index

noncoding

Max Probability

0.5139

PhyloCSF Frame 3

-5.138

CNTI Score

-0.303118866