McDonnell Genome Institute

Washington University

Transcript

PRKAG2-AS1:7

Chromosome

chr7

Gene Name

PRKAG2-AS1

Start

151877347

CPC Label

noncoding

End

151879256

Cancer

OV

Strand

+

Peptide

ALIPLGDPEGENRDGASHLK

Modified Peptide

n[145]ALIPLGDPEGENRDGASHLK

Peptide Length

20

ORF Length

41

Open Reading Frame (ORF)

LARALIPLGDPEGENRDGASHLKCFLYGQCLAIVIMCTFVD

Conservation Score

0.026

PhyloCSF Frame 1

-2.721

No. of Spectra

2

CPC Coding Probability

0.0339773

PhyloCSF Frame 2 

-4.592

CNTI Index

noncoding

Max Probability

0.424

PhyloCSF Frame 3

-3.865

CNTI Score

-0.316305935