McDonnell Genome Institute

Washington University

Transcript

PRKAG2-AS1:6

Chromosome

chr7

Gene Name

PRKAG2-AS1

Start

151877232

CPC Label

coding

End

151879450

Cancer

CCRC

Strand

+

Peptide

VGGVLAWGSLPLLL

Modified Peptide

n[230]VGGVLAWGSLPLLL

Peptide Length

14

ORF Length

35

Open Reading Frame (ORF)

LVCPPPPDAPQDGATSAPWWKVGGVLAWGSLPLLL

Conservation Score

0.187

PhyloCSF Frame 1

-5.642

No. of Spectra

193

CPC Coding Probability

0.706381

PhyloCSF Frame 2 

-4.027

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.290935492