McDonnell Genome Institute

Washington University

Transcript

PPP1R26-AS1:12

Chromosome

chr9

Gene Name

PPP1R26-AS1

Start

135458116

CPC Label

coding

End

135480734

Cancer

EOGC

Strand

-

Peptide

AAGEQGVSAVGLGHCSAGR

Modified Peptide

n[145]AAGEQGVSAVGLGHCSAGR

Peptide Length

19

ORF Length

117

Open Reading Frame (ORF)

LETVWSRLGASLGNAEKGRAQPCPPRAAGEQGVSAVGLGHCSAGRCSSEARQGWGILQTHYFKIISGTQKGCRHSTNISLLSLTQITQMFTFNHIYICYFHSFIIFSLVLDPMMSLA

Conservation Score

0.187

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.755551

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2437

PhyloCSF Frame 3

0

CNTI Score

-0.316895985