McDonnell Genome Institute

Washington University

Transcript

POU6F2-AS2:3

Chromosome

chr7

Gene Name

POU6F2-AS2

Start

38979894

CPC Label

noncoding

End

39006625

Cancer

OV

Strand

-

Peptide

MGCHHVGQAGLK

Modified Peptide

n[145]M[147]GCHHVGQAGLK

Peptide Length

12

ORF Length

43

Open Reading Frame (ORF)

MGCHHVGQAGLKLLTSGDLPASASQSAGITGVSHRARPNCIIN

Conservation Score

0.112

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0428257

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8787

PhyloCSF Frame 3

0

CNTI Score

-0.387712004