McDonnell Genome Institute

Washington University

Transcript

POTEH-AS1:1

Chromosome

chr22

Gene Name

POTEH-AS1

Start

15699360

CPC Label

noncoding

End

15703403

Cancer

OV

Strand

-

Peptide

HVLGTELNATYIFLMHSK

Modified Peptide

n[145]HVLGTELNATYIFLMHSK

Peptide Length

18

ORF Length

35

Open Reading Frame (ORF)

MVRIVVTGVSVNDANKHVLGTELNATYIFLMHSKL

Conservation Score

0.029

PhyloCSF Frame 1

-5.676

No. of Spectra

4

CPC Coding Probability

0.037348

PhyloCSF Frame 2 

-4.735

CNTI Index

noncoding

Max Probability

0.9041

PhyloCSF Frame 3

-4.169

CNTI Score

-0.401464536