McDonnell Genome Institute

Washington University

Transcript

POT1-AS1:1

Chromosome

chr7

Gene Name

POT1-AS1

Start

124925769

CPC Label

noncoding

End

124932444

Cancer

EOGC

Strand

+

Peptide

DNNVIWEFL

Modified Peptide

n[145]DNNVIWEFL

Peptide Length

9

ORF Length

112

Open Reading Frame (ORF)

LEVWRNTDRMRRQRERRAKVQAPPSPVTSPGILAAPLSSAPSDFPAFVAGGKLRGSGRVRWAGFELPFGRFEAPVGRAFLLMSSSLPPRNRHLLQSLQGSIYKDNNVIWEFL

Conservation Score

0.075

PhyloCSF Frame 1

-3.39

No. of Spectra

1

CPC Coding Probability

0.0889276

PhyloCSF Frame 2 

-2.438

CNTI Index

noncoding

Max Probability

0.9894

PhyloCSF Frame 3

-1.543

CNTI Score

-0.367934961