McDonnell Genome Institute

Washington University

Transcript

PLUT:6

Chromosome

chr13

Gene Name

PLUT

Start

27829768

CPC Label

noncoding

End

27921404

Cancer

OV

Strand

-

Peptide

MCAIVVVYISSPLIQMR

Modified Peptide

n[145]MCAIVVVYISSPLIQM[147]R

Peptide Length

17

ORF Length

37

Open Reading Frame (ORF)

MCAIVVVYISSPLIQMRAISNSETCHIIKLGVRTEPG

Conservation Score

0.182

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.155794

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.493

PhyloCSF Frame 3

0

CNTI Score

-0.310762969