McDonnell Genome Institute

Washington University

Transcript

PLCXD2-AS1:3

Chromosome

chr3

Gene Name

PLCXD2-AS1

Start

111675942

CPC Label

noncoding

End

111677428

Cancer

HCC

Strand

-

Peptide

SPLLAQK

Modified Peptide

SPLLAQK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR

Conservation Score

1

PhyloCSF Frame 1

-5.509

No. of Spectra

28

CPC Coding Probability

0.0226268

PhyloCSF Frame 2 

-4.78

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-4.78

CNTI Score

-0.373182166