McDonnell Genome Institute

Washington University

Transcript

PLCG1-AS1:9

Chromosome

chr20

Gene Name

PLCG1-AS1

Start

41131184

CPC Label

noncoding

End

41136840

Cancer

OV

Strand

-

Peptide

VQAVLPQPPESLLIWCCHRLGSLDVDSVTAWK

Modified Peptide

n[145]VQAVLPQPPESLLIWCCHRLGSLDVDSVTAWK

Peptide Length

32

ORF Length

95

Open Reading Frame (ORF)

MSFLPHRRSTGLEFLSRRPGWRAMAQSWLTAISASRVQAVLPQPPESLLIWCCHRLGSLDVDSVTAWKGVVMSWEEPSLGQMALCSQDDLRGADS

Conservation Score

0.998

PhyloCSF Frame 1

-4.234

No. of Spectra

1

CPC Coding Probability

0.118875

PhyloCSF Frame 2 

-5.033

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

-4.13

CNTI Score

-0.345917727