McDonnell Genome Institute

Washington University

Transcript

PLCE1-AS1:9

Chromosome

chr10

Gene Name

PLCE1-AS1

Start

94271680

CPC Label

noncoding

End

94287047

Cancer

BRCA-Luminal A

Strand

-

Peptide

IIDIYLLNK

Modified Peptide

n[145]IIDIYLLNK

Peptide Length

9

ORF Length

54

Open Reading Frame (ORF)

LLERMRYEKIIDIYLLNKGSEQILLFNIYALNILYRLYIHTYIILHVYVCIHVC

Conservation Score

0.874

PhyloCSF Frame 1

-5.02

No. of Spectra

9

CPC Coding Probability

0.0615428

PhyloCSF Frame 2 

-5.648

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-4.19

CNTI Score

-0.351317685