McDonnell Genome Institute

Washington University

Transcript

PKNOX2-AS1:2

Chromosome

chr11

Gene Name

PKNOX2-AS1

Start

125154988

CPC Label

noncoding

End

125164560

Cancer

OSCC

Strand

-

Peptide

MAISSCLQSPHINLLSALCEQGQK

Modified Peptide

n[145]MAISSCLQSPHINLLSALCEQGQK

Peptide Length

24

ORF Length

167

Open Reading Frame (ORF)

LHRWGYRDSLFSQLWAPSPPQFFFLGGAPQPKGWGLLERMAISSCLQSPHINLLSALCEQGQKAQKTMYRVPVPFLLAAWHLFSPRLRALNYSQKPKSWLPLGHPLKNVNPLTLRKVLLIAWTPVDLCAAANTRMACTHHIRTGRTETHSHTDTCSHRNSHKFTWKH

Conservation Score

0.91

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.353278

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6779

PhyloCSF Frame 3

0

CNTI Score

-0.310935066