McDonnell Genome Institute

Washington University

Transcript

PKIA-AS1:4

Chromosome

chr8

Gene Name

PKIA-AS1

Start

78326363

CPC Label

noncoding

End

78665982

Cancer

OV

Strand

-

Peptide

NNALSPMWAFLSPIK

Modified Peptide

n[145]NNALSPMWAFLSPIK

Peptide Length

15

ORF Length

70

Open Reading Frame (ORF)

MKGGCCLLSLLIPTLIFSRNTITDTPRNNALSPMWAFLSPIKLPHEIYHHTYLSTSAHTYFKFNPIINET

Conservation Score

0.068

PhyloCSF Frame 1

-4.829

No. of Spectra

9

CPC Coding Probability

0.0405158

PhyloCSF Frame 2 

-5.143

CNTI Index

noncoding

Max Probability

0.5508

PhyloCSF Frame 3

-4.824

CNTI Score

-0.40711703