McDonnell Genome Institute

Washington University

Transcript

PITPNA-AS1:3

Chromosome

chr17

Gene Name

PITPNA-AS1

Start

1516933

CPC Label

noncoding

End

1520561

Cancer

CRC

Strand

+

Peptide

LPEEWAQNGCVRK

Modified Peptide

LPEEWAQNGCVRK

Peptide Length

13

ORF Length

90

Open Reading Frame (ORF)

LGEHTEMDRNTMERDGGAVTTATYTPRISEEQAPAHAGSVTPDGLFVHNTEGHLELATVRNRKLPEEWAQNGCVRKWPVTWEGGAAGSSC

Conservation Score

1

PhyloCSF Frame 1

-2.787

No. of Spectra

19

CPC Coding Probability

0.181813

PhyloCSF Frame 2 

-1.783

CNTI Index

noncoding

Max Probability

0.8314

PhyloCSF Frame 3

-3.495

CNTI Score

-0.35799434