McDonnell Genome Institute

Washington University

Transcript

PISRT1:3

Chromosome

chr3

Gene Name

PISRT1

Start

139232991

CPC Label

noncoding

End

139233522

Cancer

OV

Strand

+

Peptide

AFAAMLR

Modified Peptide

n[145]AFAAMLR

Peptide Length

7

ORF Length

82

Open Reading Frame (ORF)

LKAFAAMLRVWCCLSISVCHYSYNKVLFGPFWLCFYLFFYFYFLCPQIFKDRLIFILFFNIKVTANILLKENKRYFSGFRLQ

Conservation Score

1

PhyloCSF Frame 1

-3.613

No. of Spectra

10

CPC Coding Probability

0.0815558

PhyloCSF Frame 2 

-3.134

CNTI Index

noncoding

Max Probability

0.9242

PhyloCSF Frame 3

-4.208

CNTI Score

-0.462635847