McDonnell Genome Institute

Washington University

Transcript

PINCR:6

Chromosome

chrX

Gene Name

PINCR

Start

43176993

CPC Label

noncoding

End

43226598

Cancer

OV

Strand

+

Peptide

KNINGIGK

Modified Peptide

n[145]KNINGIGK

Peptide Length

8

ORF Length

75

Open Reading Frame (ORF)

MEFFYPLQYTRVNFLHDFLLQREKCYDKVHLRTLTDHRKNINGIGKKMQTNESTTKFYLSCSSKIALFRIHYGSH

Conservation Score

1

PhyloCSF Frame 1

-5.505

No. of Spectra

54

CPC Coding Probability

0.0465378

PhyloCSF Frame 2 

-3.85

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-4.37

CNTI Score

-0.399491058