McDonnell Genome Institute

Washington University

Transcript

PIK3CD-AS2:10

Chromosome

chr1

Gene Name

PIK3CD-AS2

Start

9675402

CPC Label

noncoding

End

9687564

Cancer

LUAD

Strand

-

Peptide

MLKHDEEEEEEEK

Modified Peptide

n[43]MLKHDEEEEEEEK

Peptide Length

13

ORF Length

51

Open Reading Frame (ORF)

MLKHDEEEEEEEKRQSHWCPRNGTRSGLQEGWPPVGLGELCDADIRGLLHA

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0446513

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.316031643