McDonnell Genome Institute

Washington University

Transcript

PGR-AS1:10

Chromosome

chr11

Gene Name

PGR-AS1

Start

101208904

CPC Label

coding

End

101209450

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

HHSQQAPKAEAPCLLR

Modified Peptide

n[145]HHSQQAPKAEAPCLLR

Peptide Length

16

ORF Length

58

Open Reading Frame (ORF)

MMEEVQSLQEKVNERHHSQQAPKAEAPCLLRNSSHLSSLFPFALLQRHSSKPVLPTSG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9819

PhyloCSF Frame 3

0

CNTI Score

-0.36898533