McDonnell Genome Institute

Washington University

Transcript

PGM5P4-AS1:11

Chromosome

chr2

Gene Name

PGM5P4-AS1

Start

113540023

CPC Label

noncoding

End

113542690

Cancer

CCRC

Strand

-

Peptide

DSASRPGPSPAGR

Modified Peptide

n[230]DSASRPGPSPAGR

Peptide Length

13

ORF Length

229

Open Reading Frame (ORF)

LTVAQVDGRQRAPDEVGRVAALALEEAGGSPVLAGRGGHCPHRDATPLRGASRPVLLRLPGPEGICSRPGASASLAARRDSASRPGPSPAGRRPAPCTRPPGDRPPLLSARPLADSLGRDRFCLAAKFSPAHLLRCQTARAALSFSPSWTHFRGVPQARSQSLLARPRRRLHPRLAAASTRARRPPGRTLRQKTAGGRRDFGQSAGSSPAPGPSPVSLGVRSLHAPVSL

Conservation Score

1

PhyloCSF Frame 1

11.094

No. of Spectra

5

CPC Coding Probability

0.130045

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9958

PhyloCSF Frame 3

0.863

CNTI Score

0.751048089