McDonnell Genome Institute

Washington University

Transcript

PEG13:2

Chromosome

chr8

Gene Name

PEG13

Start

140094893

CPC Label

coding

End

140100560

Cancer

OV

Strand

-

Peptide

LRTAAEDLGER

Modified Peptide

n[145]LRTAAEDLGER

Peptide Length

11

ORF Length

44

Open Reading Frame (ORF)

LRTAAEDLGERHYFVDPGILKQLRPSCASSPVEGCGEPGWASVP

Conservation Score

0.005

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.868044

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0785

PhyloCSF Frame 3

0

CNTI Score

-0.286533831