McDonnell Genome Institute

Washington University

Transcript

PEG13:1

Chromosome

chr8

Gene Name

PEG13

Start

140094893

CPC Label

coding

End

140099137

Cancer

EOGC

Strand

-

Peptide

IQLGILILPTVAR

Modified Peptide

n[145]IQLGILILPTVAR

Peptide Length

13

ORF Length

144

Open Reading Frame (ORF)

LQRACGCAPRTHPDRRSYPVDSGTAGAVHPKIQLGILILPTVARLWPGVFMVWTAAQLRLHTTDPDGRSCLVDCGRAVAGHPRCRRVYYPATGNTGCAARTQAGVLTLGESLPYGLWHNCGWHKNPGGRPYPADSGRAAHGGLG

Conservation Score

0.037

PhyloCSF Frame 1

-2.898

No. of Spectra

1

CPC Coding Probability

0.86544

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5074

PhyloCSF Frame 3

-4.364

CNTI Score

-0.286533831