McDonnell Genome Institute

Washington University

Transcript

PCF11-AS1:2

Chromosome

chr11

Gene Name

PCF11-AS1

Start

83191028

CPC Label

noncoding

End

83193794

Cancer

PRAD

Strand

-

Peptide

FPFPQLFHGFSCGQIGR

Modified Peptide

FPFPQLFHGFSCGQIGR

Peptide Length

17

ORF Length

81

Open Reading Frame (ORF)

LERQQGRRLGNEYTSDVLRSFPVPHGPRYFRFPFPQLFHGFSCGQIGRWCKLVFGEIRLGLMRTYLGPSLEWPVIDRALHR

Conservation Score

1

PhyloCSF Frame 1

-1.683

No. of Spectra

1

CPC Coding Probability

0.00573703

PhyloCSF Frame 2 

2.502

CNTI Index

noncoding

Max Probability

0.2628

PhyloCSF Frame 3

2.923

CNTI Score

-0.39724787