McDonnell Genome Institute

Washington University

Transcript

PCF11-AS1:18

Chromosome

chr11

Gene Name

PCF11-AS1

Start

83189133

CPC Label

noncoding

End

83193663

Cancer

CCRC

Strand

-

Peptide

QYPDCMGFQGK

Modified Peptide

n[230]QYPDCM[147]GFQGK

Peptide Length

11

ORF Length

105

Open Reading Frame (ORF)

MQYPDCMGFQGKCLTMEEIFFSFFFETESRCGWSAVAQSWLTASCLLGSLHSPASASPSSWDYGRPPPRPANFFIFSRDGVSPWSRSPDLVIRPPRLPKVLGLQA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

33

CPC Coding Probability

0.270842

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9927

PhyloCSF Frame 3

0

CNTI Score

-0.386927742