McDonnell Genome Institute

Washington University

Transcript

PCED1B-AS1:6

Chromosome

chr12

Gene Name

PCED1B-AS1

Start

47206378

CPC Label

coding

End

47216434

Cancer

EOGC

Strand

-

Peptide

QFRPLALIVLAGVVCSR

Modified Peptide

n[145]QFRPLALIVLAGVVCSR

Peptide Length

17

ORF Length

35

Open Reading Frame (ORF)

LTLPLIKQFRPLALIVLAGVVCSRLKRWSEGERRK

Conservation Score

0.67

PhyloCSF Frame 1

-4.676

No. of Spectra

26

CPC Coding Probability

0.846444

PhyloCSF Frame 2 

-5.52

CNTI Index

noncoding

Max Probability

0.9415

PhyloCSF Frame 3

-6.024

CNTI Score

-0.346914679