McDonnell Genome Institute

Washington University

Transcript

PCBP1-AS1:250

Chromosome

chr2

Gene Name

PCBP1-AS1

Start

70036064

CPC Label

noncoding

End

70086946

Cancer

EOGC

Strand

-

Peptide

LESSFSLK

Modified Peptide

n[145]LESSFSLK

Peptide Length

8

ORF Length

43

Open Reading Frame (ORF)

LESSFSLKFWLKMSFFNLQQVVLIPSSDFFKFPGALILSSCFH

Conservation Score

0.915

PhyloCSF Frame 1

-5.727

No. of Spectra

4

CPC Coding Probability

0.138978

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

0

CNTI Score

-0.321338738