McDonnell Genome Institute

Washington University

Transcript

PCBP1-AS1:213

Chromosome

chr2

Gene Name

PCBP1-AS1

Start

70018014

CPC Label

coding

End

70089514

Cancer

LUAD

Strand

-

Peptide

GGMGVAR

Modified Peptide

n[230]GGMGVAR

Peptide Length

7

ORF Length

231

Open Reading Frame (ORF)

MGGMGVARSVAAPILAARADDWGAGRHGLVRNGHDSPLRRLGERLQHDQANLLDTLGDRLRHASDGDGPLGGVGQHIPRHLDLRPRTLADLFDLTPAFPNQGAALGGRHHQPQGDRGPAGRGTVGHGAVDIFLQLVDDHSESLKDGIGGAGQSDDSLRTIPLRDVDPRATLLADPLNRLPFLPNDASYFLSVHKKPNEEDKHKDEVLNSRSHNVGDGPPDFLTDLHYLVDT

Conservation Score

1

PhyloCSF Frame 1

11.96

No. of Spectra

6

CPC Coding Probability

0.999837

PhyloCSF Frame 2 

1.08

CNTI Index

coding

Max Probability

0.9945

PhyloCSF Frame 3

3.017

CNTI Score

0.734582975