McDonnell Genome Institute

Washington University

Transcript

PCBP1-AS1:153

Chromosome

chr2

Gene Name

PCBP1-AS1

Start

70055616

CPC Label

noncoding

End

70081229

Cancer

OV

Strand

-

Peptide

QLAQLLGR

Modified Peptide

n[145]QLAQLLGR

Peptide Length

8

ORF Length

167

Open Reading Frame (ORF)

MCWGWYSWVWWLTPVIPALWAQRQEDCLSLRIQDKPGQHREPLCLPKQLAQLLGRLRKTSSGLPLIVHYETESCYVAQAGLELLTSSDPPVLASQVSGLRACAITPNLIHCLYKFFFLYSKNQKKQNWIHVQNMQVCYIAVRVPWWFAAPIDLSCKFPPLTPTPQQP

Conservation Score

0.76

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.167675

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5942

PhyloCSF Frame 3

0

CNTI Score

-0.341511928