McDonnell Genome Institute

Washington University

Transcript

PCAT6:16

Chromosome

chr1

Gene Name

PCAT6

Start

202810953

CPC Label

coding

End

202831446

Cancer

OV

Strand

+

Peptide

DNIPVANK

Modified Peptide

n[145]DNIPVANK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

MIKRQITHCKNGLTDFSKDNIPVANKHMKRFHHQSLGKCKSKPQMKYHFTPTRMAIFFFFFF

Conservation Score

0.337

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.948438

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5399

PhyloCSF Frame 3

0

CNTI Score

0.731476378