McDonnell Genome Institute

Washington University

Transcript

PCAT5:1

Chromosome

chr10

Gene Name

PCAT5

Start

35778301

CPC Label

noncoding

End

35800920

Cancer

OSCC

Strand

+

Peptide

LDKIAMGSCCCSRMLPSETLTQR

Modified Peptide

n[145]LDKIAM[147]GSCCCSRMLPSETLTQR

Peptide Length

23

ORF Length

115

Open Reading Frame (ORF)

LNQATGDDQCWVSWEPEDLQLCLGSTYQQEPDEEGGCVLNCFRKSPSAQDRLDKIAMGSCCCSRMLPSETLTQRRGAEIRKAKMASKNSNTPRRPGAMAHACNPSTLEDPGGWIT

Conservation Score

0.655

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.148605

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8255

PhyloCSF Frame 3

0

CNTI Score

-0.362769778