McDonnell Genome Institute

Washington University

Transcript

PCAT19:21

Chromosome

chr19

Gene Name

PCAT19

Start

41498358

CPC Label

noncoding

End

41500644

Cancer

CCRC

Strand

-

Peptide

LCAEEGR

Modified Peptide

n[230]LCAEEGR

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

LCAEEGRLSIWRKPTAGDTSMGSEGLRMRSRTGSREGGGFRG

Conservation Score

0.047

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.1572

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.993

PhyloCSF Frame 3

0

CNTI Score

-0.365526323