McDonnell Genome Institute

Washington University

Transcript

PCAT19:19

Chromosome

chr19

Gene Name

PCAT19

Start

41454171

CPC Label

coding

End

41501223

Cancer

HCC

Strand

-

Peptide

AESFPDK

Modified Peptide

n[230]AESFPDK

Peptide Length

7

ORF Length

124

Open Reading Frame (ORF)

LPETNSTLIAHIMGSFISLIKNLAKEEIVPKVASILTDMLEKWCADQFMTCVPKLATEIVFAVLRSLIQMMLIYVLEKAESFPDKLLKLFRNISYFLKKMMSGQAAQEEEGNLEEFPDLLCCCD

Conservation Score

0.04

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.844832

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9365

PhyloCSF Frame 3

0

CNTI Score

0.652457034