McDonnell Genome Institute

Washington University

Transcript

PCAT14:6

Chromosome

chr22

Gene Name

PCAT14

Start

23536880

CPC Label

noncoding

End

23539480

Cancer

PRAD

Strand

+

Peptide

ATLEPFQTGEDIVSVSDAPK

Modified Peptide

‚Äč

Peptide Length

20

ORF Length

202

Open Reading Frame (ORF)

MGQTESKYASYLSFIKILLRRGGVRASTENLITLFQTIEQFCPWFPEQGTLDLKDWEKIGKELKQANREGKIIPLTVWNDWAIIKATLEPFQTGEDIVSVSDAPKSCVTDCEEEAGTESQQGTESSHCKYVAESVMAQSTQNVDYSQLQEIIYPESSKLGEGGPESLGPSEPKPRSPSTPPPVVQMPVTLQPQTQVRQAQTP

Conservation Score

0.512

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.221542

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.403111135