McDonnell Genome Institute

Washington University

Transcript

PCAT1:6

Chromosome

chr8

Gene Name

PCAT1

Start

127183916

CPC Label

noncoding

End

127203395

Cancer

OSCC

Strand

+

Peptide

SDNTLHMGK

Modified Peptide

n[145]SDNTLHM[147]GK

Peptide Length

9

ORF Length

93

Open Reading Frame (ORF)

LDSSEQEWGQGTSEETVAIITKSGAAAWTRELAVEAERSDNTLHMGKGGQERTVPKMIQYFGLRSWGKRNNNNNISGRGFRESRCSGCSFVLP

Conservation Score

0.323

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0606284

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5672

PhyloCSF Frame 3

0

CNTI Score

-0.351757605