McDonnell Genome Institute

Washington University

Transcript

PCAT1:44

Chromosome

chr8

Gene Name

PCAT1

Start

127244636

CPC Label

noncoding

End

127374179

Cancer

OV

Strand

+

Peptide

ELIFQLK

Modified Peptide

n[145]ELIFQLK

Peptide Length

7

ORF Length

106

Open Reading Frame (ORF)

LSAWKLLMQCPRWRKVRVDPEEPREDVQHGDLGSSQGPYFSDGVSLSPRLECSGAISAHYRLCPLVSRHSPASASRVAGTTGVEKYIISNFKELIFQLKKPFMLFN

Conservation Score

0.992

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.221339

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9301

PhyloCSF Frame 3

0

CNTI Score

-0.42444409