McDonnell Genome Institute

Washington University

Transcript

PCAT1:4

Chromosome

chr8

Gene Name

PCAT1

Start

127013153

CPC Label

coding

End

127021014

Cancer

OV

Strand

+

Peptide

DIGYLHR

Modified Peptide

n[145]DIGYLHR

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MDIGYLHRQLAPRRCLPVQMGRKGKWQGGRESICTLTIW

Conservation Score

0.67

PhyloCSF Frame 1

-4.742

No. of Spectra

10

CPC Coding Probability

0.653143

PhyloCSF Frame 2 

-5.238

CNTI Index

noncoding

Max Probability

0.9625

PhyloCSF Frame 3

-5.201

CNTI Score

-0.342647866